"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"J7S6N7"	"{'domain_architectures': 23307, 'entries': 12, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'cdd': 1, 'ssf': 1, 'pfam': 1, 'panther': 1, 'prints': 1, 'prosite': 2, 'interpro': 4}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 23307}"	"['Destroys radicals which are normally produced within the cells and which are toxic to biological systems']"	"KNAG0D01290"	"[{'identifier': 'GO:0046872', 'name': 'metal ion binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006801', 'name': 'superoxide metabolic process', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0005507', 'name': 'copper ion binding', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"J7S6N7_HUIN7"	"0b25ab25edf1e8018697f8e0f82edf2240257a20"	True	False	False	154	"Superoxide dismutase [Cu-Zn]"	3	"UP000006310"	"MVKAVAVLKGSAGIGGVVHFEQASENENTTISWEITGNDANAQRGFHIHEFGDITNGCVSAGPHFNPFKKTHGAPTDEVRHVGDMGNVTTDANGVAKGSRTDPLIKLLGPTTIIGRSVVIHAGTDDLGKGDNEESLKTGNAGGRPACGVIGFTN"	"unreviewed"	"{'taxId': '1071383', 'scientificName': 'Huiozyma naganishii (strain ATCC MYA-139 / BCRC 22969 / CBS 8797 / KCTC 17520 / NBRC 10181 / NCYC 3082 / Yp74L-3)', 'fullName': 'Huiozyma naganishii (strain ATCC MYA-139 / BCRC 22969 / CBS 8797 / KCTC 17520 / NBRC 10181 / NCYC 3082 / Yp74L-3) (Yeast)'}"
