General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "J6F515",
        "id": "J6F515_TRIAS",
        "source_organism": {
            "taxId": "1186058",
            "scientificName": "Trichosporon asahii var. asahii (strain ATCC 90039 / CBS 2479 / JCM 2466 / KCTC 7840 / NBRC 103889/ NCYC 2677 / UAMH 7654)",
            "fullName": "Trichosporon asahii var. asahii (strain ATCC 90039 / CBS 2479 / JCM 2466 / KCTC 7840 / NBRC 103889/ NCYC 2677 / UAMH 7654) (Yeast)"
        },
        "name": "tRNA(Ile)-lysidine/2-thiocytidine synthase N-terminal domain-containing protein",
        "description": [
            "Plays a central role in 2-thiolation of mcm(5)S(2)U at tRNA wobble positions of tRNA(Lys), tRNA(Glu) and tRNA(Gln). Directly binds tRNAs and probably acts by catalyzing adenylation of tRNAs, an intermediate required for 2-thiolation. It is unclear whether it acts as a sulfurtransferase that transfers sulfur from thiocarboxylated URM1 onto the uridine of tRNAs at wobble position"
        ],
        "length": 350,
        "sequence": "MPTQCSICESARALVKRPKTGQQVCKQCFFDVFETEVHETITKSGAGGGSIFERGERVAIGASGGKDSTVLAHVLTTLNQRYDYGLDLHLLSIDEGIKGYRDDSLETVKQNQAEYGLPLKILSYDELYGWTMDRVVDQVGKKNNCTFCGVFRRQALDRGAAELGIEHIVTGHNADDIAETVLMNILRGDVARLGRCTAVTTQGDDTIKRSKPFKYAYEKEIVMYAYFKKLTYFSTECIYSPEGSGGGAPLSDHRHHPFRRELRARQEDEGQLEVHAAADTSPRTISAKPALSCRVSRADLIARLSYSPSGEAPAGQRTIPKYQRKLRVAEGTEGVEGIERPLAKLEVSAE",
        "proteome": null,
        "gene": "A1Q1_06642",
        "go_terms": null,
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "a0ea2b86ad0fa017098d8c054aa86406cf39d11b",
        "counters": {
            "domain_architectures": 21347,
            "entries": 8,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "cdd": 1,
                "pfam": 1,
                "panther": 1,
                "interpro": 3
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 21347
        }
    }
}