"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"J6F515"	"{'domain_architectures': 21347, 'entries': 8, 'isoforms': 0, 'proteomes': 0, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'cdd': 1, 'pfam': 1, 'panther': 1, 'interpro': 3}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 21347}"	"['Plays a central role in 2-thiolation of mcm(5)S(2)U at tRNA wobble positions of tRNA(Lys), tRNA(Glu) and tRNA(Gln). Directly binds tRNAs and probably acts by catalyzing adenylation of tRNAs, an intermediate required for 2-thiolation. It is unclear whether it acts as a sulfurtransferase that transfers sulfur from thiocarboxylated URM1 onto the uridine of tRNAs at wobble position']"	"A1Q1_06642"	""	"J6F515_TRIAS"	"a0ea2b86ad0fa017098d8c054aa86406cf39d11b"	True	False	False	350	"tRNA(Ile)-lysidine/2-thiocytidine synthase N-terminal domain-containing protein"	4	""	"MPTQCSICESARALVKRPKTGQQVCKQCFFDVFETEVHETITKSGAGGGSIFERGERVAIGASGGKDSTVLAHVLTTLNQRYDYGLDLHLLSIDEGIKGYRDDSLETVKQNQAEYGLPLKILSYDELYGWTMDRVVDQVGKKNNCTFCGVFRRQALDRGAAELGIEHIVTGHNADDIAETVLMNILRGDVARLGRCTAVTTQGDDTIKRSKPFKYAYEKEIVMYAYFKKLTYFSTECIYSPEGSGGGAPLSDHRHHPFRRELRARQEDEGQLEVHAAADTSPRTISAKPALSCRVSRADLIARLSYSPSGEAPAGQRTIPKYQRKLRVAEGTEGVEGIERPLAKLEVSAE"	"unreviewed"	"{'taxId': '1186058', 'scientificName': 'Trichosporon asahii var. asahii (strain ATCC 90039 / CBS 2479 / JCM 2466 / KCTC 7840 / NBRC 103889/ NCYC 2677 / UAMH 7654)', 'fullName': 'Trichosporon asahii var. asahii (strain ATCC 90039 / CBS 2479 / JCM 2466 / KCTC 7840 / NBRC 103889/ NCYC 2677 / UAMH 7654) (Yeast)'}"