General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "J4UHQ8",
        "id": "OPS6_BEAB2",
        "source_organism": {
            "taxId": "655819",
            "scientificName": "Beauveria bassiana (strain ARSEF 2860)",
            "fullName": "Beauveria bassiana (strain ARSEF 2860) (White muscardine disease fungus)"
        },
        "name": "Glutathione S-transferase-like protein OpS6",
        "description": [
            "Glutathione S-transferase-like protein; part of the gene cluster that mediates the biosynthesis of the bibenzoquinone oosporein, a metabolite required for fungal virulence that acts by evading host immunity to facilitate fungal multiplication in insects (PubMed:26305932, PubMed:28193896). The non-reducing polyketide synthase OpS1 produces orsellinic acid by condensing acetyl-CoA with 3 malonyl-CoA units (PubMed:26305932). Orsellinic acid is then hydroxylated to benzenetriol by the hydroxylase OpS4 (PubMed:26305932). The intermediate is oxidized either nonenzymatically to 5,5'-dideoxy-oosporein or enzymatically to benzenetetrol by the oxidoreductase OpS7 (PubMed:26305932). The latter is further dimerized to oosporein by the catalase OpS5 (PubMed:26305932). OpS6 probably functions en route for protecting cells against oxidative stress by scavenging any leaked free radical form of benzenetetrol by activating the thiol group of glutathione (PubMed:26305932)"
        ],
        "length": 218,
        "sequence": "MASLQPIKLYAHKKGPNPWKVALILEELGLPYETTYLEFPDAKVEPYISLNPNGKLPAIQDPNHSIELFESGAIIEYLIEQYDKDGKLSHESLQDKSLARAWLHLQMSAQAPVIGYKVWMGRTYDASQIVSANEFLTLEIKRVLGVLDKHLAKMGGPYLLGSKVSYADLAFVPHYMMLPLFVPDYDPATEYPHFAAWLAALKERPAVKKIAATKAALA",
        "proteome": "UP000002762",
        "gene": "OpS6",
        "go_terms": null,
        "protein_evidence": 2,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "3c8295a330c09bde936e9b1d621b2d95072ea793",
        "counters": {
            "domain_architectures": 15127,
            "entries": 17,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 3,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 2,
                "profile": 2,
                "pfam": 2,
                "cdd": 1,
                "panther": 1,
                "sfld": 2,
                "interpro": 6
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 15127
        }
    }
}