General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "J3JWG5",
        "id": "J3JWG5_DENPD",
        "source_organism": {
            "taxId": "77166",
            "scientificName": "Dendroctonus ponderosae",
            "fullName": "Dendroctonus ponderosae (Mountain pine beetle)"
        },
        "name": "Rho GDP-dissociation inhibitor 3",
        "description": [
            "Inhibits GDP/GTP exchange reaction of RhoB. Interacts specifically with the GDP- and GTP-bound forms of post-translationally processed Rhob and Rhog proteins, both of which show a growth-regulated expression in mammalian cells. Stimulates the release of the GDP-bound but not the GTP-bound RhoB protein. Also inhibits the GDP/GTP exchange of RhoB but shows less ability to inhibit the dissociation of prebound GTP"
        ],
        "length": 203,
        "sequence": "MADIEEQQVTTPEDVDKEPESNYKPPPEKTISELLEIDQEDESLRKYKETLLGQAQIGPIIVEPDNPKKVIVKRLVLIPVDRPELSLDLTGDISRLKQETFVIKEGVSYKIRIEFFVQREIVHGLKYVQKTSKMGITVDKMTHMVGSYAPKTEIQSYTTPAEDAPSGMLARGSYTVHSLFTDDDKNEHLKWEWTFEIKKDWKD",
        "proteome": "UP000019118",
        "gene": "109533316",
        "go_terms": [
            {
                "identifier": "GO:0005094",
                "name": "Rho GDP-dissociation inhibitor activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0005515",
                "name": "protein binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0007266",
                "name": "Rho protein signal transduction",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005737",
                "name": "cytoplasm",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 2,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "a047cc2a90c5a451e918e7e7fd5504acdc6be23f",
        "counters": {
            "domain_architectures": 7757,
            "entries": 8,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "pfam": 1,
                "cathgene3d": 1,
                "panther": 1,
                "prints": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 7757
        }
    }
}