"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"J3JWG5"	"{'domain_architectures': 7757, 'entries': 8, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'ssf': 1, 'pfam': 1, 'cathgene3d': 1, 'panther': 1, 'prints': 1, 'interpro': 3}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 7757}"	"['Inhibits GDP/GTP exchange reaction of RhoB. Interacts specifically with the GDP- and GTP-bound forms of post-translationally processed Rhob and Rhog proteins, both of which show a growth-regulated expression in mammalian cells. Stimulates the release of the GDP-bound but not the GTP-bound RhoB protein. Also inhibits the GDP/GTP exchange of RhoB but shows less ability to inhibit the dissociation of prebound GTP']"	"109533316"	"[{'identifier': 'GO:0005094', 'name': 'Rho GDP-dissociation inhibitor activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0005515', 'name': 'protein binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0007266', 'name': 'Rho protein signal transduction', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0005737', 'name': 'cytoplasm', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"J3JWG5_DENPD"	"a047cc2a90c5a451e918e7e7fd5504acdc6be23f"	True	False	False	203	"Rho GDP-dissociation inhibitor 3"	2	"UP000019118"	"MADIEEQQVTTPEDVDKEPESNYKPPPEKTISELLEIDQEDESLRKYKETLLGQAQIGPIIVEPDNPKKVIVKRLVLIPVDRPELSLDLTGDISRLKQETFVIKEGVSYKIRIEFFVQREIVHGLKYVQKTSKMGITVDKMTHMVGSYAPKTEIQSYTTPAEDAPSGMLARGSYTVHSLFTDDDKNEHLKWEWTFEIKKDWKD"	"unreviewed"	"{'taxId': '77166', 'scientificName': 'Dendroctonus ponderosae', 'fullName': 'Dendroctonus ponderosae (Mountain pine beetle)'}"
