General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "I7KDI2",
        "id": "I7KDI2_METBM",
        "source_organism": {
            "taxId": "1201294",
            "scientificName": "Methanoculleus bourgensis (strain ATCC 43281 / DSM 3045 / OCM 15 / MS2)",
            "fullName": "Methanoculleus bourgensis (strain ATCC 43281 / DSM 3045 / OCM 15 / MS2)"
        },
        "name": "CDP-archaeol synthase",
        "description": [
            "Catalyzes the formation of CDP-2,3-bis-(O-geranylgeranyl)-sn-glycerol (CDP-archaeol) from 2,3-bis-(O-geranylgeranyl)-sn-glycerol 1-phosphate (DGGGP) and CTP. This reaction is the third ether-bond-formation step in the biosynthesis of archaeal membrane lipids"
        ],
        "length": 166,
        "sequence": "MIPAYVPNSAAAALGGGTPIDFGKVCSDSRRVFGDGKTYRGFFGGVLCGILAGLVEIWAWSSFNLTVLPRQTLLSVTLLAAGALLGDLVKSFLKRRLGKERGESWPIADQYDLVIGSFLLMLLIYPQWLFENITLPIAVWIVIITPLLHRVVNIIGYYIGVKEVPW",
        "proteome": "UP000009007",
        "gene": "carS",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "6968c3f11b24377191ced249622177963ec52177",
        "counters": {
            "domain_architectures": 1257,
            "entries": 6,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "panther": 1,
                "hamap": 1,
                "ncbifam": 1,
                "pfam": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 1257
        }
    }
}