"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"I7KDI2"	"{'domain_architectures': 1257, 'entries': 6, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'panther': 1, 'hamap': 1, 'ncbifam': 1, 'pfam': 1, 'interpro': 2}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 1257}"	"['Catalyzes the formation of CDP-2,3-bis-(O-geranylgeranyl)-sn-glycerol (CDP-archaeol) from 2,3-bis-(O-geranylgeranyl)-sn-glycerol 1-phosphate (DGGGP) and CTP. This reaction is the third ether-bond-formation step in the biosynthesis of archaeal membrane lipids']"	"carS"	""	"I7KDI2_METBM"	"6968c3f11b24377191ced249622177963ec52177"	True	False	False	166	"CDP-archaeol synthase"	3	"UP000009007"	"MIPAYVPNSAAAALGGGTPIDFGKVCSDSRRVFGDGKTYRGFFGGVLCGILAGLVEIWAWSSFNLTVLPRQTLLSVTLLAAGALLGDLVKSFLKRRLGKERGESWPIADQYDLVIGSFLLMLLIYPQWLFENITLPIAVWIVIITPLLHRVVNIIGYYIGVKEVPW"	"unreviewed"	"{'taxId': '1201294', 'scientificName': 'Methanoculleus bourgensis (strain ATCC 43281 / DSM 3045 / OCM 15 / MS2)', 'fullName': 'Methanoculleus bourgensis (strain ATCC 43281 / DSM 3045 / OCM 15 / MS2)'}"