General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "I7J0N8",
        "id": "I7J0N8_9BURK",
        "source_organism": {
            "taxId": "1091495",
            "scientificName": "Taylorella asinigenitalis 14/45",
            "fullName": "Taylorella asinigenitalis 14/45"
        },
        "name": "Peptidoglycan-associated lipoprotein",
        "description": [
            "Part of the Tol-Pal system, which plays a role in outer membrane invagination during cell division and is important for maintaining outer membrane integrity"
        ],
        "length": 168,
        "sequence": "MSLRIIKSISLASIVLALAACSTTETSTTNEGATTTTVNQNGTPVQVILDPFNPASPLYQNKSVYFAFDRYDVEPQYNEMLQLHAKYLTSNAQRSVRIEGNTDLRGSSEYNLALGQRRSVAVARMLNQYGVNSAQIEAVSFGKERPQAMGNSEEAHAQNRRADIQYMK",
        "proteome": null,
        "gene": "pal",
        "go_terms": [
            {
                "identifier": "GO:0051301",
                "name": "cell division",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0009279",
                "name": "cell outer membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0016020",
                "name": "membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "d85a19a2a4ac97490a47ac4a7f38220da449100b",
        "counters": {
            "domain_architectures": 60963,
            "entries": 16,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "profile": 2,
                "cathgene3d": 1,
                "ssf": 1,
                "cdd": 1,
                "hamap": 1,
                "panther": 1,
                "ncbifam": 1,
                "pfam": 1,
                "prints": 1,
                "interpro": 6
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 60963
        }
    }
}