"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"I7J0N8"	"{'domain_architectures': 60963, 'entries': 16, 'isoforms': 0, 'proteomes': 0, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'profile': 2, 'cathgene3d': 1, 'ssf': 1, 'cdd': 1, 'hamap': 1, 'panther': 1, 'ncbifam': 1, 'pfam': 1, 'prints': 1, 'interpro': 6}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 60963}"	"['Part of the Tol-Pal system, which plays a role in outer membrane invagination during cell division and is important for maintaining outer membrane integrity']"	"pal"	"[{'identifier': 'GO:0051301', 'name': 'cell division', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0009279', 'name': 'cell outer membrane', 'category': {'code': 'C', 'name': 'cellular_component'}}, {'identifier': 'GO:0016020', 'name': 'membrane', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"I7J0N8_9BURK"	"d85a19a2a4ac97490a47ac4a7f38220da449100b"	True	False	False	168	"Peptidoglycan-associated lipoprotein"	3	""	"MSLRIIKSISLASIVLALAACSTTETSTTNEGATTTTVNQNGTPVQVILDPFNPASPLYQNKSVYFAFDRYDVEPQYNEMLQLHAKYLTSNAQRSVRIEGNTDLRGSSEYNLALGQRRSVAVARMLNQYGVNSAQIEAVSFGKERPQAMGNSEEAHAQNRRADIQYMK"	"unreviewed"	"{'taxId': '1091495', 'scientificName': 'Taylorella asinigenitalis 14/45', 'fullName': 'Taylorella asinigenitalis 14/45'}"
