General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "I6UM89",
        "id": "I6UM89_HRV14",
        "source_organism": {
            "taxId": "12131",
            "scientificName": "Human rhinovirus 14",
            "fullName": "Human rhinovirus 14 (HRV-14)"
        },
        "name": "Genome polyprotein",
        "description": [
            "Forms an icosahedral capsid of pseudo T=3 symmetry with capsid proteins VP2 and VP3. The capsid is 300 Angstroms in diameter, composed of 60 copies of each capsid protein and enclosing the viral positive strand RNA genome"
        ],
        "length": 132,
        "sequence": "MGAQVSTQKSGSHENQNILTNGSNQTFTVINYYKDAASSSSAGQSLSMDPSKFTEPVKDLMLKGAPALNSPNVEACGYRDRVQQITLGNSTITTQEAANAVVCYAEWPEYLPDKDASDVNKTSKPDTSVCRF",
        "proteome": null,
        "gene": null,
        "go_terms": [
            {
                "identifier": "GO:0005198",
                "name": "structural molecule activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0019028",
                "name": "viral capsid",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": true,
        "in_alphafold": false,
        "in_bfvd": false,
        "ida_accession": "2a297b5891e22c0dfc5e7b249dd30862d848d828",
        "counters": {
            "domain_architectures": 3944,
            "entries": 7,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "ssf": 1,
                "pfam": 1,
                "interpro": 3
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 3944
        }
    }
}