GET /api/protein/UniProt/I6UM89/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "I6UM89",
"id": "I6UM89_HRV14",
"source_organism": {
"taxId": "12131",
"scientificName": "Human rhinovirus 14",
"fullName": "Human rhinovirus 14 (HRV-14)"
},
"name": "Genome polyprotein",
"description": [
"Forms an icosahedral capsid of pseudo T=3 symmetry with capsid proteins VP2 and VP3. The capsid is 300 Angstroms in diameter, composed of 60 copies of each capsid protein and enclosing the viral positive strand RNA genome"
],
"length": 132,
"sequence": "MGAQVSTQKSGSHENQNILTNGSNQTFTVINYYKDAASSSSAGQSLSMDPSKFTEPVKDLMLKGAPALNSPNVEACGYRDRVQQITLGNSTITTQEAANAVVCYAEWPEYLPDKDASDVNKTSKPDTSVCRF",
"proteome": null,
"gene": null,
"go_terms": [
{
"identifier": "GO:0005198",
"name": "structural molecule activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0019028",
"name": "viral capsid",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 4,
"source_database": "unreviewed",
"is_fragment": true,
"in_alphafold": false,
"in_bfvd": false,
"ida_accession": "2a297b5891e22c0dfc5e7b249dd30862d848d828",
"counters": {
"domain_architectures": 3944,
"entries": 7,
"isoforms": 0,
"proteomes": 0,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 2,
"ssf": 1,
"pfam": 1,
"interpro": 3
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 3944
}
}
}