"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"I6UM89"	"{'domain_architectures': 3944, 'entries': 7, 'isoforms': 0, 'proteomes': 0, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 2, 'ssf': 1, 'pfam': 1, 'interpro': 3}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 3944}"	"['Forms an icosahedral capsid of pseudo T=3 symmetry with capsid proteins VP2 and VP3. The capsid is 300 Angstroms in diameter, composed of 60 copies of each capsid protein and enclosing the viral positive strand RNA genome']"	""	"[{'identifier': 'GO:0005198', 'name': 'structural molecule activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0019028', 'name': 'viral capsid', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"I6UM89_HRV14"	"2a297b5891e22c0dfc5e7b249dd30862d848d828"	False	False	True	132	"Genome polyprotein"	4	""	"MGAQVSTQKSGSHENQNILTNGSNQTFTVINYYKDAASSSSAGQSLSMDPSKFTEPVKDLMLKGAPALNSPNVEACGYRDRVQQITLGNSTITTQEAANAVVCYAEWPEYLPDKDASDVNKTSKPDTSVCRF"	"unreviewed"	"{'taxId': '12131', 'scientificName': 'Human rhinovirus 14', 'fullName': 'Human rhinovirus 14 (HRV-14)'}"