GET /api/protein/UniProt/I6ULP1/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "I6ULP1",
"id": "I6ULP1_9CNID",
"source_organism": {
"taxId": "1196843",
"scientificName": "Trichogorgia capensis",
"fullName": "Trichogorgia capensis"
},
"name": "NADH-ubiquinone oxidoreductase chain 4L",
"description": [
"Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) which catalyzes electron transfer from NADH through the respiratory chain, using ubiquinone as an electron acceptor"
],
"length": 49,
"sequence": "VLYTLFGQIFAIMILTVAAAESAIGLAIMVNYYRLRGTIAVRALNLLRG",
"proteome": null,
"gene": "nad4L",
"go_terms": [
{
"identifier": "GO:0016651",
"name": "oxidoreductase activity, acting on NAD(P)H",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0042773",
"name": "ATP synthesis coupled electron transport",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": true,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "5c384e151efd07be17d94f5774ea581a4dbdd6cf",
"counters": {
"domain_architectures": 70833,
"entries": 5,
"isoforms": 0,
"proteomes": 0,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"panther": 1,
"pfam": 1,
"interpro": 2
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 70833
}
}
}