"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"I6ULP1"	"{'domain_architectures': 70833, 'entries': 5, 'isoforms': 0, 'proteomes': 0, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'panther': 1, 'pfam': 1, 'interpro': 2}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 70833}"	"['Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) which catalyzes electron transfer from NADH through the respiratory chain, using ubiquinone as an electron acceptor']"	"nad4L"	"[{'identifier': 'GO:0016651', 'name': 'oxidoreductase activity, acting on NAD(P)H', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0042773', 'name': 'ATP synthesis coupled electron transport', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"I6ULP1_9CNID"	"5c384e151efd07be17d94f5774ea581a4dbdd6cf"	True	False	True	49	"NADH-ubiquinone oxidoreductase chain 4L"	3	""	"VLYTLFGQIFAIMILTVAAAESAIGLAIMVNYYRLRGTIAVRALNLLRG"	"unreviewed"	"{'taxId': '1196843', 'scientificName': 'Trichogorgia capensis', 'fullName': 'Trichogorgia capensis'}"
