HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "I5D601",
"id": "I5D601_MYCAA",
"source_organism": {
"taxId": "1110504",
"scientificName": "Mycoplasmopsis agalactiae 14628",
"fullName": "Mycoplasmopsis agalactiae 14628"
},
"name": "Elongation factor P",
"description": [
"Involved in peptide bond synthesis. Stimulates efficient translation and peptide-bond synthesis on native or reconstituted 70S ribosomes in vitro. Probably functions indirectly by altering the affinity of the ribosome for aminoacyl-tRNA, thus increasing their reactivity as acceptors for peptidyl transferase"
],
"length": 187,
"sequence": "MINVNTFKPGITFEDDGDIFVVLEAQHSKQGRGQANVKAKVKNLRTGSTVIKSYTGGVMVSRAHIDKRPMSYLYSDGENIILMDTETYEQVEIPVSHVEWELNFLKEGMIVKIRKYKEEILDIELDANVVLEVTEAPDAVKGNTANNPQKKVKLETGFELETPMFISEGEKIIVSTETGKYVGRANK",
"proteome": null,
"gene": "efp",
"go_terms": [
{
"identifier": "GO:0003746",
"name": "translation elongation factor activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006414",
"name": "translational elongation",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0043043",
"name": "peptide biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0005737",
"name": "cytoplasm",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "fc01dc10f98ced482098f920742884a9a4952237",
"counters": {
"domain_architectures": 28575,
"entries": 23,
"isoforms": 0,
"proteomes": 0,
"sets": 3,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 2,
"cathgene3d": 2,
"pfam": 3,
"cdd": 1,
"smart": 2,
"pirsf": 1,
"hamap": 1,
"ncbifam": 2,
"panther": 1,
"interpro": 8
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 28575
}
}
}