"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"I5D601"	"{'domain_architectures': 28575, 'entries': 23, 'isoforms': 0, 'proteomes': 0, 'sets': 3, 'structures': 0, 'taxa': 1, 'dbEntries': {'ssf': 2, 'cathgene3d': 2, 'pfam': 3, 'cdd': 1, 'smart': 2, 'pirsf': 1, 'hamap': 1, 'ncbifam': 2, 'panther': 1, 'interpro': 8}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 28575}"	"['Involved in peptide bond synthesis. Stimulates efficient translation and peptide-bond synthesis on native or reconstituted 70S ribosomes in vitro. Probably functions indirectly by altering the affinity of the ribosome for aminoacyl-tRNA, thus increasing their reactivity as acceptors for peptidyl transferase']"	"efp"	"[{'identifier': 'GO:0003746', 'name': 'translation elongation factor activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006414', 'name': 'translational elongation', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0043043', 'name': 'peptide biosynthetic process', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0005737', 'name': 'cytoplasm', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"I5D601_MYCAA"	"fc01dc10f98ced482098f920742884a9a4952237"	True	False	False	187	"Elongation factor P"	3	""	"MINVNTFKPGITFEDDGDIFVVLEAQHSKQGRGQANVKAKVKNLRTGSTVIKSYTGGVMVSRAHIDKRPMSYLYSDGENIILMDTETYEQVEIPVSHVEWELNFLKEGMIVKIRKYKEEILDIELDANVVLEVTEAPDAVKGNTANNPQKKVKLETGFELETPMFISEGEKIIVSTETGKYVGRANK"	"unreviewed"	"{'taxId': '1110504', 'scientificName': 'Mycoplasmopsis agalactiae 14628', 'fullName': 'Mycoplasmopsis agalactiae 14628'}"