General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "I3R661",
        "id": "I3R661_HALMT",
        "source_organism": {
            "taxId": "523841",
            "scientificName": "Haloferax mediterranei (strain ATCC 33500 / DSM 1411 / JCM 8866 / NBRC 14739 / NCIMB 2177 / R-4)",
            "fullName": "Haloferax mediterranei (strain ATCC 33500 / DSM 1411 / JCM 8866 / NBRC 14739 / NCIMB 2177 / R-4)"
        },
        "name": "Coenzyme F420:L-glutamate ligase",
        "description": [
            "Catalyzes the GTP-dependent successive addition of two or more gamma-linked L-glutamates to the L-lactyl phosphodiester of 7,8-didemethyl-8-hydroxy-5-deazariboflavin (F420-0) to form coenzyme F420-0-glutamyl-glutamate (F420-2) or polyglutamated F420 derivatives"
        ],
        "length": 251,
        "sequence": "MELFPVPDVPEIREGDDLAALISERVDLRPGDVVCVASTVVSKAEGRFADLDDFPAGPRARELAARLSELTDDEKDPRFAQAVLEESVDLVMDEPFLLTETRFGHVGVNAGIDRSNVPDHDLLLLPKRPNKSAERICAGITADRVIVSDTCGRPFRHGQRGVALGWAGLSASRDWRGETDRDGRELGVTVESVVDELAAAANLVQGEGDDGTPVVVVRNFEWGDHGESEAHFRDIDGDFVRQALRDWSYEP",
        "proteome": "UP000011603",
        "gene": "cofE",
        "go_terms": [
            {
                "identifier": "GO:0043773",
                "name": "coenzyme F420-0 gamma-glutamyl ligase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0046872",
                "name": "metal ion binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "2e6257df10632a0bd65b623bfefe4b6c5862dac5",
        "counters": {
            "domain_architectures": 4763,
            "entries": 11,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cathgene3d": 2,
                "hamap": 1,
                "ncbifam": 2,
                "panther": 1,
                "pfam": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 4763
        }
    }
}