"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"I3R661"	"{'domain_architectures': 4763, 'entries': 11, 'isoforms': 0, 'proteomes': 1, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'ssf': 1, 'cathgene3d': 2, 'hamap': 1, 'ncbifam': 2, 'panther': 1, 'pfam': 1, 'interpro': 3}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 4763}"	"['Catalyzes the GTP-dependent successive addition of two or more gamma-linked L-glutamates to the L-lactyl phosphodiester of 7,8-didemethyl-8-hydroxy-5-deazariboflavin (F420-0) to form coenzyme F420-0-glutamyl-glutamate (F420-2) or polyglutamated F420 derivatives']"	"cofE"	"[{'identifier': 'GO:0043773', 'name': 'coenzyme F420-0 gamma-glutamyl ligase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0046872', 'name': 'metal ion binding', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"I3R661_HALMT"	"2e6257df10632a0bd65b623bfefe4b6c5862dac5"	True	False	False	251	"Coenzyme F420:L-glutamate ligase"	3	"UP000011603"	"MELFPVPDVPEIREGDDLAALISERVDLRPGDVVCVASTVVSKAEGRFADLDDFPAGPRARELAARLSELTDDEKDPRFAQAVLEESVDLVMDEPFLLTETRFGHVGVNAGIDRSNVPDHDLLLLPKRPNKSAERICAGITADRVIVSDTCGRPFRHGQRGVALGWAGLSASRDWRGETDRDGRELGVTVESVVDELAAAANLVQGEGDDGTPVVVVRNFEWGDHGESEAHFRDIDGDFVRQALRDWSYEP"	"unreviewed"	"{'taxId': '523841', 'scientificName': 'Haloferax mediterranei (strain ATCC 33500 / DSM 1411 / JCM 8866 / NBRC 14739 / NCIMB 2177 / R-4)', 'fullName': 'Haloferax mediterranei (strain ATCC 33500 / DSM 1411 / JCM 8866 / NBRC 14739 / NCIMB 2177 / R-4)'}"