General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "I3MP25",
        "id": "I3MP25_ICTTR",
        "source_organism": {
            "taxId": "43179",
            "scientificName": "Ictidomys tridecemlineatus",
            "fullName": "Ictidomys tridecemlineatus (Thirteen-lined ground squirrel)"
        },
        "name": "Synembryn",
        "description": [
            "Chaperone that specifically binds and folds nascent G alpha proteins prior to G protein heterotrimer formation, promoting their stability and activity: folds GNAI1, GNAO1, GNA13 and GNAQ. Does not fold G(s) G-alpha proteins GNAS nor GNAL. Also acts as a guanine nucleotide exchange factor (GEF) for G alpha proteins by stimulating exchange of bound GDP for free GTP. Involved in regulation of microtubule pulling forces during mitotic movement of chromosomes by stimulating G(i)-alpha protein (GNAI1), possibly leading to release G(i)-alpha-GTP and NuMA proteins from the NuMA-GPSM2-G(i)-alpha-GDP complex. Also acts as an activator for G(q)-alpha (GNAQ) protein by enhancing the G(q)-coupled receptor-mediated ERK activation",
            "Chaperone that specifically binds and folds nascent G alpha proteins prior to G protein heterotrimer formation. Also acts as a guanine nucleotide exchange factor (GEF) for G alpha proteins by stimulating exchange of bound GDP for free GTP"
        ],
        "length": 530,
        "sequence": "MEPRAVADALETGKEDVITEALRTYNREHSQSFTFDEAQQEDRKRLAELLVTVLEQGLPPSHRVTWLQTVRILSRDRSCLDPFTSRQSLHALACYAGISASEGSVPESPDMDVILESLKCLCNLVLSSPVAQTLAAEAHLVVRLAERVGTYSKKSFPHDVQFFDLRLLFLLTALRTDVRQQLFQELHGVHLLTHTLELTLGMTPEESPPDLLPPQETERAMEILKVLFNITFDSIKREVDEEDTALYQYLGTLLRHCVMVAAAGDRTEEFHGHTVNLLGNLPLKCLDVLLALELHEGSLEFMGVNMDVIGVLLAFLEKRLHQTHRLKESVAPVLSVLTECARMHRPVRKFLKAQVLPPLRDVRTRPEVGELLRNKLVRLMTHLDTDVKRVAAEFLFVLCSESVPRFIKYTGYGNAAGLLAARGLMAGGRPEGQYSEDEDTDTDEYKEAKASINPVTGRVEEKPPNPMEGMTEEQKEHEAMKLVNMFDKLSRHRVIQPMGMSPRGHLTSLQDAMCETMEGQLSSDPDSDPD",
        "proteome": "UP000005215",
        "gene": "RIC8A",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "75915d1d069a341bf0e426c0b7060a71405751d2",
        "counters": {
            "domain_architectures": 5302,
            "entries": 9,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "panther": 1,
                "pfam": 1,
                "prints": 1,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 5302
        }
    }
}