"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"I3MP25"	"{'domain_architectures': 5302, 'entries': 9, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'panther': 1, 'pfam': 1, 'prints': 1, 'interpro': 4}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 5302}"	"['Chaperone that specifically binds and folds nascent G alpha proteins prior to G protein heterotrimer formation, promoting their stability and activity: folds GNAI1, GNAO1, GNA13 and GNAQ. Does not fold G(s) G-alpha proteins GNAS nor GNAL. Also acts as a guanine nucleotide exchange factor (GEF) for G alpha proteins by stimulating exchange of bound GDP for free GTP. Involved in regulation of microtubule pulling forces during mitotic movement of chromosomes by stimulating G(i)-alpha protein (GNAI1), possibly leading to release G(i)-alpha-GTP and NuMA proteins from the NuMA-GPSM2-G(i)-alpha-GDP complex. Also acts as an activator for G(q)-alpha (GNAQ) protein by enhancing the G(q)-coupled receptor-mediated ERK activation', 'Chaperone that specifically binds and folds nascent G alpha proteins prior to G protein heterotrimer formation. Also acts as a guanine nucleotide exchange factor (GEF) for G alpha proteins by stimulating exchange of bound GDP for free GTP']"	"RIC8A"	""	"I3MP25_ICTTR"	"75915d1d069a341bf0e426c0b7060a71405751d2"	True	False	False	530	"Synembryn"	3	"UP000005215"	"MEPRAVADALETGKEDVITEALRTYNREHSQSFTFDEAQQEDRKRLAELLVTVLEQGLPPSHRVTWLQTVRILSRDRSCLDPFTSRQSLHALACYAGISASEGSVPESPDMDVILESLKCLCNLVLSSPVAQTLAAEAHLVVRLAERVGTYSKKSFPHDVQFFDLRLLFLLTALRTDVRQQLFQELHGVHLLTHTLELTLGMTPEESPPDLLPPQETERAMEILKVLFNITFDSIKREVDEEDTALYQYLGTLLRHCVMVAAAGDRTEEFHGHTVNLLGNLPLKCLDVLLALELHEGSLEFMGVNMDVIGVLLAFLEKRLHQTHRLKESVAPVLSVLTECARMHRPVRKFLKAQVLPPLRDVRTRPEVGELLRNKLVRLMTHLDTDVKRVAAEFLFVLCSESVPRFIKYTGYGNAAGLLAARGLMAGGRPEGQYSEDEDTDTDEYKEAKASINPVTGRVEEKPPNPMEGMTEEQKEHEAMKLVNMFDKLSRHRVIQPMGMSPRGHLTSLQDAMCETMEGQLSSDPDSDPD"	"unreviewed"	"{'taxId': '43179', 'scientificName': 'Ictidomys tridecemlineatus', 'fullName': 'Ictidomys tridecemlineatus (Thirteen-lined ground squirrel)'}"