GET /api/protein/UniProt/I3MIC5/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "I3MIC5",
        "id": "I3MIC5_ICTTR",
        "source_organism": {
            "taxId": "43179",
            "scientificName": "Ictidomys tridecemlineatus",
            "fullName": "Ictidomys tridecemlineatus (Thirteen-lined ground squirrel)"
        },
        "name": "Zinc finger CCCH-type with G patch domain-containing protein",
        "description": [
            "Transcription repressor that specifically binds the 5'-GGAG[GA]A[GA]A-3' consensus sequence. Represses transcription by recruiting the chromatin multiprotein complex NuRD to target promoters. Negatively regulates expression of EGFR, a gene involved in cell proliferation, survival and migration. Its ability to repress genes of the EGFR pathway suggest it may act as a tumor suppressor"
        ],
        "length": 465,
        "sequence": "GAGLEAAEQADLRQLQADLRELIGLTEASLVSVRKSKLLAALDAEAAGVPAGPEMAPEGEAGPGPAEPGRADPDPDPDPGELSGAKVNAPYRSAWGTLEYHNAMVVGTEAAEDGSAGVRVLYLYPTHKSLKPCPFFLEGKCRFKDSCRFSHGQVVSVDELRPFQDPDLSLLQAGSTCLAKHQDGLWHPARILDVDNGYYTVKFDSLLLKEAVVEGDSILPPLRTEAAESSDSDSGDAVDSSYARVVESGTADTGTCSSAFAGWEVHTRGIGSRLLAKMGYEFGKGLGRHAEGRVEPIHAVVLPRGKSLDQCAEILQKRTKRSHAGASRPPRCQGSGSGPGGRPPPRNVFDFLNEKLQSQAPGALEAGAGPPGRRSQDMYHASKSAKQALSLRLFQTEEKIVRTQRDIQGIQEALTRNAGRHSVAAAQLEEKLAGAQRQLGQLRAQEAGLQREQRKADTHRKMTEF",
        "proteome": "UP000005215",
        "gene": "ZGPAT",
        "go_terms": [
            {
                "identifier": "GO:0046872",
                "name": "metal ion binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0003676",
                "name": "nucleic acid binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "a956554feafcbf58694e4d10123da3e3d2b08047",
        "counters": {
            "domain_architectures": 372,
            "entries": 14,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 3,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "smart": 2,
                "profile": 2,
                "pfam": 2,
                "cdd": 1,
                "ssf": 1,
                "panther": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 372
        }
    }
}