GET /api/protein/UniProt/I3MIC5/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "I3MIC5",
"id": "I3MIC5_ICTTR",
"source_organism": {
"taxId": "43179",
"scientificName": "Ictidomys tridecemlineatus",
"fullName": "Ictidomys tridecemlineatus (Thirteen-lined ground squirrel)"
},
"name": "Zinc finger CCCH-type with G patch domain-containing protein",
"description": [
"Transcription repressor that specifically binds the 5'-GGAG[GA]A[GA]A-3' consensus sequence. Represses transcription by recruiting the chromatin multiprotein complex NuRD to target promoters. Negatively regulates expression of EGFR, a gene involved in cell proliferation, survival and migration. Its ability to repress genes of the EGFR pathway suggest it may act as a tumor suppressor"
],
"length": 465,
"sequence": "GAGLEAAEQADLRQLQADLRELIGLTEASLVSVRKSKLLAALDAEAAGVPAGPEMAPEGEAGPGPAEPGRADPDPDPDPGELSGAKVNAPYRSAWGTLEYHNAMVVGTEAAEDGSAGVRVLYLYPTHKSLKPCPFFLEGKCRFKDSCRFSHGQVVSVDELRPFQDPDLSLLQAGSTCLAKHQDGLWHPARILDVDNGYYTVKFDSLLLKEAVVEGDSILPPLRTEAAESSDSDSGDAVDSSYARVVESGTADTGTCSSAFAGWEVHTRGIGSRLLAKMGYEFGKGLGRHAEGRVEPIHAVVLPRGKSLDQCAEILQKRTKRSHAGASRPPRCQGSGSGPGGRPPPRNVFDFLNEKLQSQAPGALEAGAGPPGRRSQDMYHASKSAKQALSLRLFQTEEKIVRTQRDIQGIQEALTRNAGRHSVAAAQLEEKLAGAQRQLGQLRAQEAGLQREQRKADTHRKMTEF",
"proteome": "UP000005215",
"gene": "ZGPAT",
"go_terms": [
{
"identifier": "GO:0046872",
"name": "metal ion binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0003676",
"name": "nucleic acid binding",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 4,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "a956554feafcbf58694e4d10123da3e3d2b08047",
"counters": {
"domain_architectures": 372,
"entries": 14,
"isoforms": 0,
"proteomes": 1,
"sets": 3,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 2,
"smart": 2,
"profile": 2,
"pfam": 2,
"cdd": 1,
"ssf": 1,
"panther": 1,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 372
}
}
}