General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "I2BAJ4",
        "id": "I2BAJ4_SHIBC",
        "source_organism": {
            "taxId": "630626",
            "scientificName": "Shimwellia blattae (strain ATCC 29907 / DSM 4481 / JCM 1650 / NBRC 105725 / CDC 9005-74)",
            "fullName": "Shimwellia blattae (strain ATCC 29907 / DSM 4481 / JCM 1650 / NBRC 105725 / CDC 9005-74)"
        },
        "name": "Sulfurtransferase",
        "description": [
            "Part of a sulfur-relay system required for 2-thiolation of 5-methylaminomethyl-2-thiouridine (mnm(5)s(2)U) at tRNA wobble positions. Could accept sulfur from TusD"
        ],
        "length": 109,
        "sequence": "MLTFNGKEFDTDSEGYLKDSSAWSEGLAEVIAAGEGISLSPEHWEVVRFVRDFYLEFNTSPAIRMLVKAMAKKYGDEKGNSRYLYRLFPKGPAKQATKIAGLPKPVKCI",
        "proteome": "UP000001955",
        "gene": "tusE",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "7fa7ce65eed907fa83f323a0370b60b3dadb3091",
        "counters": {
            "domain_architectures": 5925,
            "entries": 12,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "ssf": 1,
                "panther": 1,
                "ncbifam": 2,
                "pirsf": 1,
                "pfam": 1,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 5925
        }
    }
}