"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"I2BAJ4"	"{'domain_architectures': 5925, 'entries': 12, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 2, 'ssf': 1, 'panther': 1, 'ncbifam': 2, 'pirsf': 1, 'pfam': 1, 'interpro': 4}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 5925}"	"['Part of a sulfur-relay system required for 2-thiolation of 5-methylaminomethyl-2-thiouridine (mnm(5)s(2)U) at tRNA wobble positions. Could accept sulfur from TusD']"	"tusE"	""	"I2BAJ4_SHIBC"	"7fa7ce65eed907fa83f323a0370b60b3dadb3091"	True	False	False	109	"Sulfurtransferase"	3	"UP000001955"	"MLTFNGKEFDTDSEGYLKDSSAWSEGLAEVIAAGEGISLSPEHWEVVRFVRDFYLEFNTSPAIRMLVKAMAKKYGDEKGNSRYLYRLFPKGPAKQATKIAGLPKPVKCI"	"unreviewed"	"{'taxId': '630626', 'scientificName': 'Shimwellia blattae (strain ATCC 29907 / DSM 4481 / JCM 1650 / NBRC 105725 / CDC 9005-74)', 'fullName': 'Shimwellia blattae (strain ATCC 29907 / DSM 4481 / JCM 1650 / NBRC 105725 / CDC 9005-74)'}"