HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "I2B9W3",
"id": "I2B9W3_SHIBC",
"source_organism": {
"taxId": "630626",
"scientificName": "Shimwellia blattae (strain ATCC 29907 / DSM 4481 / JCM 1650 / NBRC 105725 / CDC 9005-74)",
"fullName": "Shimwellia blattae (strain ATCC 29907 / DSM 4481 / JCM 1650 / NBRC 105725 / CDC 9005-74)"
},
"name": "Spermidine export protein MdtI",
"description": [
"Catalyzes the excretion of spermidine"
],
"length": 109,
"sequence": "MPSFEWIHAAWLALAIVLEIAANILLKYSAGFRRPLYGILSLLAVLGAFSALGQAVKGIELSVAYAVWGGFGIMATVAAGWVLFGQRLNTRGWAGITLLMVAMVMIKLA",
"proteome": "UP000001955",
"gene": "mdtI",
"go_terms": [
{
"identifier": "GO:0015606",
"name": "spermidine transmembrane transporter activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0015848",
"name": "spermidine transport",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0005886",
"name": "plasma membrane",
"category": {
"code": "C",
"name": "cellular_component"
}
},
{
"identifier": "GO:0022857",
"name": "transmembrane transporter activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0016020",
"name": "membrane",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "6e12b6fab6ef66c4df13b2b7534ff73ca4958d16",
"counters": {
"domain_architectures": 39415,
"entries": 10,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"ncbifam": 1,
"hamap": 1,
"panther": 1,
"pfam": 1,
"interpro": 4
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 39415
}
}
}