"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"I2B9W3"	"{'domain_architectures': 39415, 'entries': 10, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'ncbifam': 1, 'hamap': 1, 'panther': 1, 'pfam': 1, 'interpro': 4}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 39415}"	"['Catalyzes the excretion of spermidine']"	"mdtI"	"[{'identifier': 'GO:0015606', 'name': 'spermidine transmembrane transporter activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0015848', 'name': 'spermidine transport', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0005886', 'name': 'plasma membrane', 'category': {'code': 'C', 'name': 'cellular_component'}}, {'identifier': 'GO:0022857', 'name': 'transmembrane transporter activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0016020', 'name': 'membrane', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"I2B9W3_SHIBC"	"6e12b6fab6ef66c4df13b2b7534ff73ca4958d16"	True	False	False	109	"Spermidine export protein MdtI"	3	"UP000001955"	"MPSFEWIHAAWLALAIVLEIAANILLKYSAGFRRPLYGILSLLAVLGAFSALGQAVKGIELSVAYAVWGGFGIMATVAAGWVLFGQRLNTRGWAGITLLMVAMVMIKLA"	"unreviewed"	"{'taxId': '630626', 'scientificName': 'Shimwellia blattae (strain ATCC 29907 / DSM 4481 / JCM 1650 / NBRC 105725 / CDC 9005-74)', 'fullName': 'Shimwellia blattae (strain ATCC 29907 / DSM 4481 / JCM 1650 / NBRC 105725 / CDC 9005-74)'}"