General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "H9G667",
        "id": "H9G667_ANOCA",
        "source_organism": {
            "taxId": "28377",
            "scientificName": "Anolis carolinensis",
            "fullName": "Anolis carolinensis (Green anole)"
        },
        "name": "Peroxisomal coenzyme A diphosphatase NUDT7",
        "description": [
            "Fatty acyl-coenzyme A (CoA) diphosphatase that hydrolyzes fatty acyl-CoA to yield acyl-4'-phosphopantetheine and adenosine 3',5'-bisphosphate. Cleaves CoA, CoA esters and oxidized CoA with similar efficiencies. Preferentially hydrolyzes medium-chain acyl-CoAs and bile acid-CoAs. Has no activity toward NDP-sugars, CDP-alcohols, (deoxy)nucleoside 5'-triphosphates, nucleoside 5'-di or monophosphates, diadenosine polyphosphates, NAD, NADH, NADP, NADPH or thymidine-5'-monophospho-p-nitrophenyl ester. May be required to eliminate oxidized CoA from peroxisomes, or regulate CoA and acyl-CoA levels in this organelle in response to metabolic demand. Does not play a role in U8 snoRNA decapping activity. Binds U8 snoRNA. Exhibits decapping activity towards dpCoA-capped RNAs in vitro"
        ],
        "length": 239,
        "sequence": "MAAAEVSVEDWRRMDVKDKAKLQLKKFDIGERFSHFPGGKASVLLPLMVKDGKLHLLFTVRSMQLRRSPGDVCFPGGRREPTDKDEIDTALRESQEEIGLHPEQAEVICRLVPVLDKTDSLVTPVVAFIEDTFHAHPNPEEVSDTFSMPLEYFIRPSKYNGITVPLNGIPYLMHTFEYDDPEHKRSFKIVGLTAHIAVFLALAVFGEKPTFEVPYDLENLNSSAVNLFLERYKKAKSKL",
        "proteome": "UP000001646",
        "gene": "NUDT7",
        "go_terms": [
            {
                "identifier": "GO:0010945",
                "name": "coenzyme A diphosphatase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0000287",
                "name": "magnesium ion binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016818",
                "name": "hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0030145",
                "name": "manganese ion binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "752b3b6d9807717ea1f029db1420a2538cb188ca",
        "counters": {
            "domain_architectures": 250306,
            "entries": 11,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "profile": 1,
                "cdd": 1,
                "pfam": 1,
                "panther": 1,
                "prosite": 1,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 250306
        }
    }
}