"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"H9G667"	"{'domain_architectures': 250306, 'entries': 11, 'isoforms': 0, 'proteomes': 1, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'profile': 1, 'cdd': 1, 'pfam': 1, 'panther': 1, 'prosite': 1, 'interpro': 4}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 250306}"	"[""Fatty acyl-coenzyme A (CoA) diphosphatase that hydrolyzes fatty acyl-CoA to yield acyl-4'-phosphopantetheine and adenosine 3',5'-bisphosphate. Cleaves CoA, CoA esters and oxidized CoA with similar efficiencies. Preferentially hydrolyzes medium-chain acyl-CoAs and bile acid-CoAs. Has no activity toward NDP-sugars, CDP-alcohols, (deoxy)nucleoside 5'-triphosphates, nucleoside 5'-di or monophosphates, diadenosine polyphosphates, NAD, NADH, NADP, NADPH or thymidine-5'-monophospho-p-nitrophenyl ester. May be required to eliminate oxidized CoA from peroxisomes, or regulate CoA and acyl-CoA levels in this organelle in response to metabolic demand. Does not play a role in U8 snoRNA decapping activity. Binds U8 snoRNA. Exhibits decapping activity towards dpCoA-capped RNAs in vitro""]"	"NUDT7"	"[{'identifier': 'GO:0010945', 'name': 'coenzyme A diphosphatase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0000287', 'name': 'magnesium ion binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0016818', 'name': 'hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0030145', 'name': 'manganese ion binding', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"H9G667_ANOCA"	"752b3b6d9807717ea1f029db1420a2538cb188ca"	True	False	False	239	"Peroxisomal coenzyme A diphosphatase NUDT7"	3	"UP000001646"	"MAAAEVSVEDWRRMDVKDKAKLQLKKFDIGERFSHFPGGKASVLLPLMVKDGKLHLLFTVRSMQLRRSPGDVCFPGGRREPTDKDEIDTALRESQEEIGLHPEQAEVICRLVPVLDKTDSLVTPVVAFIEDTFHAHPNPEEVSDTFSMPLEYFIRPSKYNGITVPLNGIPYLMHTFEYDDPEHKRSFKIVGLTAHIAVFLALAVFGEKPTFEVPYDLENLNSSAVNLFLERYKKAKSKL"	"unreviewed"	"{'taxId': '28377', 'scientificName': 'Anolis carolinensis', 'fullName': 'Anolis carolinensis (Green anole)'}"