General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "H3ZM41",
        "id": "H3ZM41_THELN",
        "source_organism": {
            "taxId": "523849",
            "scientificName": "Thermococcus litoralis (strain ATCC 51850 / DSM 5473 / JCM 8560 / NS-C)",
            "fullName": "Thermococcus litoralis (strain ATCC 51850 / DSM 5473 / JCM 8560 / NS-C)"
        },
        "name": "tRNA-splicing endonuclease",
        "description": [
            "Endonuclease that removes tRNA introns. Cleaves pre-tRNA at the 5'- and 3'-splice sites to release the intron. The products are an intron and two tRNA half-molecules bearing 2',3' cyclic phosphate and 5'-OH termini. Recognizes a pseudosymmetric substrate in which 2 bulged loops of 3 bases are separated by a stem of 4 bp"
        ],
        "length": 170,
        "sequence": "MSEFKFYLSGDRVFSTMESAINKLYNKRHYGEVVNGKLFLSLIEAAYLLDKGWIKVFDGEKELRVQELFEIGRKKDEQFDLKFLVYRDLRNRGYTVKTALKYGSHFRVYRKGMEEHADWLIWVVSENQKMYPNDLTARVRVAHGVRKKMVLAVVDEDNDVVYYHIGRIKF",
        "proteome": "UP000015502",
        "gene": "endA",
        "go_terms": [
            {
                "identifier": "GO:0000213",
                "name": "tRNA-intron lyase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006388",
                "name": "tRNA splicing, via endonucleolytic cleavage and ligation",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0003676",
                "name": "nucleic acid binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "941abee8bd23336a20187cbb8cd57119e9ef0738",
        "counters": {
            "domain_architectures": 2064,
            "entries": 18,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 3,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 2,
                "pfam": 2,
                "cathgene3d": 2,
                "cdd": 1,
                "hamap": 1,
                "pirsf": 1,
                "ncbifam": 1,
                "panther": 1,
                "interpro": 7
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 2064
        }
    }
}