General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "H2XZ76",
        "id": "H2XZ76_CIOIN",
        "source_organism": {
            "taxId": "7719",
            "scientificName": "Ciona intestinalis",
            "fullName": "Ciona intestinalis (Transparent sea squirt)"
        },
        "name": "DNA replication complex GINS protein PSF1",
        "description": [
            "Required for correct functioning of the GINS complex, a complex that plays an essential role in the initiation of DNA replication, and progression of DNA replication forks. GINS complex is a core component of CDC45-MCM-GINS (CMG) helicase, the molecular machine that unwinds template DNA during replication, and around which the replisome is built",
            "Required for correct functioning of the GINS complex, a complex that plays an essential role in the initiation of DNA replication, and progression of DNA replication forks. GINS complex seems to bind preferentially to single-stranded DNA"
        ],
        "length": 195,
        "sequence": "MFGEKALDLIREVHRTREGSLGPYNEDGVRQVLEEMQVLYEANQQDVAQLVQNDSDQTSLTAVQIRHDSLQRNKRCLLAYLYNRLQKIRALRWEFGSVLPTDVRGNMSPKEIEWFTKYNRALANYMRSLGNGGLDLTQDLHPPQNVHIEVRCVEDKGELELDDGSKILLKKNSLHYLPRSQCEHLIRQGVLKHVT",
        "proteome": "UP000008144",
        "gene": "LOC100182896",
        "go_terms": [
            {
                "identifier": "GO:0006260",
                "name": "DNA replication",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0000811",
                "name": "GINS complex",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "0a6e7fca5ebfeed72c6e0ddbcc49892f88dd5056",
        "counters": {
            "domain_architectures": 3493,
            "entries": 11,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 3,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "cdd": 2,
                "pfam": 2,
                "panther": 1,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 3493
        }
    }
}