"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"H2XZ76"	"{'domain_architectures': 3493, 'entries': 11, 'isoforms': 0, 'proteomes': 1, 'sets': 3, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'cdd': 2, 'pfam': 2, 'panther': 1, 'interpro': 4}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 3493}"	"['Required for correct functioning of the GINS complex, a complex that plays an essential role in the initiation of DNA replication, and progression of DNA replication forks. GINS complex is a core component of CDC45-MCM-GINS (CMG) helicase, the molecular machine that unwinds template DNA during replication, and around which the replisome is built', 'Required for correct functioning of the GINS complex, a complex that plays an essential role in the initiation of DNA replication, and progression of DNA replication forks. GINS complex seems to bind preferentially to single-stranded DNA']"	"LOC100182896"	"[{'identifier': 'GO:0006260', 'name': 'DNA replication', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0000811', 'name': 'GINS complex', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"H2XZ76_CIOIN"	"0a6e7fca5ebfeed72c6e0ddbcc49892f88dd5056"	True	False	False	195	"DNA replication complex GINS protein PSF1"	3	"UP000008144"	"MFGEKALDLIREVHRTREGSLGPYNEDGVRQVLEEMQVLYEANQQDVAQLVQNDSDQTSLTAVQIRHDSLQRNKRCLLAYLYNRLQKIRALRWEFGSVLPTDVRGNMSPKEIEWFTKYNRALANYMRSLGNGGLDLTQDLHPPQNVHIEVRCVEDKGELELDDGSKILLKKNSLHYLPRSQCEHLIRQGVLKHVT"	"unreviewed"	"{'taxId': '7719', 'scientificName': 'Ciona intestinalis', 'fullName': 'Ciona intestinalis (Transparent sea squirt)'}"