GET /api/protein/UniProt/H2PJM6/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "H2PJM6",
        "id": "H2PJM6_PONAB",
        "source_organism": {
            "taxId": "9601",
            "scientificName": "Pongo abelii",
            "fullName": "Pongo abelii (Sumatran orangutan)"
        },
        "name": "Interleukin-1 receptor-associated kinase 1-binding protein 1",
        "description": [
            "Component of the IRAK1-dependent TNFRSF1A signaling pathway that leads to NF-kappa-B activation and is required for cell survival. Acts by enhancing RELA transcriptional activity"
        ],
        "length": 279,
        "sequence": "MSLQKTPPTRVFVELVPWADRSRENNLVSGGETLPGLRHHLSSTQAQTATREVHVSGTSEVSAGPDRAQVVVRVSSTKEAAAEAKKSVCRRLDYITQSLQQQGVQAENITVTKDFRRVENAYHMEAEVCITFTEFGKMQNICNFLVEKLDSSVVISPPQFYHTPGSVENLRRQACLVAVENAWRKAQEVCNLVGQTLGKPLLIKEEETKEWEGQIDDHQSSRLSSSLTVQQKIKSATIHAASKVFITFEQLLESFFNIPTNNYSQIAMSPVNYHESHIK",
        "proteome": "UP000001595",
        "gene": "IRAK1BP1",
        "go_terms": [
            {
                "identifier": "GO:0006955",
                "name": "immune response",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0043123",
                "name": "positive regulation of canonical NF-kappaB signal transduction",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "b0a347e8c5f642ecae602971bb04b3ddb37e6d30",
        "counters": {
            "domain_architectures": 22793,
            "entries": 6,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "panther": 1,
                "pfam": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 22793
        }
    }
}