GET /api/protein/UniProt/H2L5T3/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "H2L5T3",
        "id": "H2L5T3_ORYLA",
        "source_organism": {
            "taxId": "8090",
            "scientificName": "Oryzias latipes",
            "fullName": "Oryzias latipes (Japanese rice fish)"
        },
        "name": "S-phase kinase-associated protein 1",
        "description": [
            "Essential component of the SCF (SKP1-CUL1-F-box protein) ubiquitin ligase complex, which mediates the ubiquitination of proteins involved in cell cycle progression, signal transduction and transcription. In the SCF complex, serves as an adapter that links the F-box protein to CUL1"
        ],
        "length": 163,
        "sequence": "MPTIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGMDDEGDDDPVPLPNVNAAILKKVIQWCTHHKDDPPPPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTCKTVANMIKGKTPEEIRKTFNIKNDFTEEEEAQVRKENQWCEEK",
        "proteome": "UP000001038",
        "gene": "SKP1",
        "go_terms": [
            {
                "identifier": "GO:0006511",
                "name": "ubiquitin-dependent protein catabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "3199382cafd42d17192238da0f86c9cfb0634da5",
        "counters": {
            "domain_architectures": 10809,
            "entries": 15,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "smart": 1,
                "cathgene3d": 1,
                "ssf": 2,
                "pfam": 2,
                "cdd": 1,
                "panther": 1,
                "pirsf": 1,
                "interpro": 6
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 10809
        }
    }
}