"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"H2L5T3"	"{'domain_architectures': 10809, 'entries': 15, 'isoforms': 0, 'proteomes': 1, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'smart': 1, 'cathgene3d': 1, 'ssf': 2, 'pfam': 2, 'cdd': 1, 'panther': 1, 'pirsf': 1, 'interpro': 6}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 10809}"	"['Essential component of the SCF (SKP1-CUL1-F-box protein) ubiquitin ligase complex, which mediates the ubiquitination of proteins involved in cell cycle progression, signal transduction and transcription. In the SCF complex, serves as an adapter that links the F-box protein to CUL1']"	"SKP1"	"[{'identifier': 'GO:0006511', 'name': 'ubiquitin-dependent protein catabolic process', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"H2L5T3_ORYLA"	"3199382cafd42d17192238da0f86c9cfb0634da5"	True	False	False	163	"S-phase kinase-associated protein 1"	3	"UP000001038"	"MPTIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGMDDEGDDDPVPLPNVNAAILKKVIQWCTHHKDDPPPPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTCKTVANMIKGKTPEEIRKTFNIKNDFTEEEEAQVRKENQWCEEK"	"unreviewed"	"{'taxId': '8090', 'scientificName': 'Oryzias latipes', 'fullName': 'Oryzias latipes (Japanese rice fish)'}"