General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "H2B1N4",
        "id": "H2B1N4_KAZAF",
        "source_organism": {
            "taxId": "1071382",
            "scientificName": "Kazachstania africana (strain ATCC 22294 / BCRC 22015 / CBS 2517 / CECT 1963 / NBRC 1671 / NRRL Y-8276)",
            "fullName": "Kazachstania africana (strain ATCC 22294 / BCRC 22015 / CBS 2517 / CECT 1963 / NBRC 1671 / NRRL Y-8276) (Yeast)"
        },
        "name": "DNA repair protein RAD51 homolog",
        "description": [
            "Required both for recombination and for the repair of DNA damage caused by X-rays"
        ],
        "length": 372,
        "sequence": "MSQVQEEVVEESQNIEIPESIVASTIEPNENITSQQGNDEDLNEDDVALASFVPLEKLQVNGITTTDLKKLRENGLHTAEAVAYVPRKDLLEIKGISEAKADKLLSEASRLVPMGFVTAADFHSRRAEMICLTTGSKNLDTLLGGGVETGSITELFGEFRTGKSQLCHTLAVTCQIPLDIGGGEGKCLYIDTEGTFRPIRLVSIAQRFGLDPDDALNNVAYARAYNADHQLRLLDAAAQMMSESRFSLIIVDSVMALYRTDFSGRGELSARQMHLAKFMRSLQRLADQFGVAVVVTNQVVAQVDGSSMFNPDPKKPIGGNIMAHSSTTRLGFKKGRGAQRICKVVDSPCLPEAECVFAIYEDGIGDPREDDE",
        "proteome": "UP000005220",
        "gene": "KAFR0K01800",
        "go_terms": [
            {
                "identifier": "GO:0000166",
                "name": "nucleotide binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0003677",
                "name": "DNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0005524",
                "name": "ATP binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0140664",
                "name": "ATP-dependent DNA damage sensor activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006281",
                "name": "DNA repair",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0008094",
                "name": "ATP-dependent activity, acting on DNA",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006259",
                "name": "DNA metabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0000150",
                "name": "DNA strand exchange activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0003690",
                "name": "double-stranded DNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0003697",
                "name": "single-stranded DNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0000724",
                "name": "double-strand break repair via homologous recombination",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:1990426",
                "name": "mitotic recombination-dependent replication fork processing",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "c8df90c6b2b58269ecf5a106897e30287760edef",
        "counters": {
            "domain_architectures": 5114,
            "entries": 23,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 3,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "ssf": 2,
                "pfam": 2,
                "profile": 2,
                "cdd": 1,
                "smart": 1,
                "panther": 1,
                "pirsf": 1,
                "ncbifam": 2,
                "interpro": 9
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 5114
        }
    }
}