"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"H2B1N4"	"{'domain_architectures': 5114, 'entries': 23, 'isoforms': 0, 'proteomes': 1, 'sets': 3, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 2, 'ssf': 2, 'pfam': 2, 'profile': 2, 'cdd': 1, 'smart': 1, 'panther': 1, 'pirsf': 1, 'ncbifam': 2, 'interpro': 9}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 5114}"	"['Required both for recombination and for the repair of DNA damage caused by X-rays']"	"KAFR0K01800"	"[{'identifier': 'GO:0000166', 'name': 'nucleotide binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0003677', 'name': 'DNA binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0005524', 'name': 'ATP binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0140664', 'name': 'ATP-dependent DNA damage sensor activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006281', 'name': 'DNA repair', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0008094', 'name': 'ATP-dependent activity, acting on DNA', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006259', 'name': 'DNA metabolic process', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0000150', 'name': 'DNA strand exchange activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0003690', 'name': 'double-stranded DNA binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0003697', 'name': 'single-stranded DNA binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0000724', 'name': 'double-strand break repair via homologous recombination', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:1990426', 'name': 'mitotic recombination-dependent replication fork processing', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"H2B1N4_KAZAF"	"c8df90c6b2b58269ecf5a106897e30287760edef"	True	False	False	372	"DNA repair protein RAD51 homolog"	3	"UP000005220"	"MSQVQEEVVEESQNIEIPESIVASTIEPNENITSQQGNDEDLNEDDVALASFVPLEKLQVNGITTTDLKKLRENGLHTAEAVAYVPRKDLLEIKGISEAKADKLLSEASRLVPMGFVTAADFHSRRAEMICLTTGSKNLDTLLGGGVETGSITELFGEFRTGKSQLCHTLAVTCQIPLDIGGGEGKCLYIDTEGTFRPIRLVSIAQRFGLDPDDALNNVAYARAYNADHQLRLLDAAAQMMSESRFSLIIVDSVMALYRTDFSGRGELSARQMHLAKFMRSLQRLADQFGVAVVVTNQVVAQVDGSSMFNPDPKKPIGGNIMAHSSTTRLGFKKGRGAQRICKVVDSPCLPEAECVFAIYEDGIGDPREDDE"	"unreviewed"	"{'taxId': '1071382', 'scientificName': 'Kazachstania africana (strain ATCC 22294 / BCRC 22015 / CBS 2517 / CECT 1963 / NBRC 1671 / NRRL Y-8276)', 'fullName': 'Kazachstania africana (strain ATCC 22294 / BCRC 22015 / CBS 2517 / CECT 1963 / NBRC 1671 / NRRL Y-8276) (Yeast)'}"