General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "H0ZT64",
        "id": "H0ZT64_TAEGU",
        "source_organism": {
            "taxId": "59729",
            "scientificName": "Taeniopygia guttata",
            "fullName": "Taeniopygia guttata (Zebra finch)"
        },
        "name": "Apovitellenin-1",
        "description": [
            "Protein component of the very low density lipoprotein (VLDL) of egg-laying females. Potent lipoprotein lipase inhibitor, preventing the loss of triglycerides from VLDL on their way from the liver to the growing oocytes"
        ],
        "length": 106,
        "sequence": "MLQSRALVIALILLLSTTLPEVQSKSIFDKDRRELLAIPETIASYFYEAMNKVSPKVSQFLLDTVQSPTVVAARQRIVKEANKVSIMFEQLVEKIKSLWYTRVLGY",
        "proteome": "UP000007754",
        "gene": "LOC100227541",
        "go_terms": [
            {
                "identifier": "GO:0004857",
                "name": "enzyme inhibitor activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006629",
                "name": "lipid metabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0042627",
                "name": "chylomicron",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "95d0618a5d789bab41d63c0b7724f4c54f8f126e",
        "counters": {
            "domain_architectures": 414,
            "entries": 2,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 1,
                "interpro": 1
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 414
        }
    }
}