"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"H0ZT64"	"{'domain_architectures': 414, 'entries': 2, 'isoforms': 0, 'proteomes': 1, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'pfam': 1, 'interpro': 1}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 414}"	"['Protein component of the very low density lipoprotein (VLDL) of egg-laying females. Potent lipoprotein lipase inhibitor, preventing the loss of triglycerides from VLDL on their way from the liver to the growing oocytes']"	"LOC100227541"	"[{'identifier': 'GO:0004857', 'name': 'enzyme inhibitor activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006629', 'name': 'lipid metabolic process', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0042627', 'name': 'chylomicron', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"H0ZT64_TAEGU"	"95d0618a5d789bab41d63c0b7724f4c54f8f126e"	True	False	False	106	"Apovitellenin-1"	3	"UP000007754"	"MLQSRALVIALILLLSTTLPEVQSKSIFDKDRRELLAIPETIASYFYEAMNKVSPKVSQFLLDTVQSPTVVAARQRIVKEANKVSIMFEQLVEKIKSLWYTRVLGY"	"unreviewed"	"{'taxId': '59729', 'scientificName': 'Taeniopygia guttata', 'fullName': 'Taeniopygia guttata (Zebra finch)'}"