General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "H0XUQ3",
        "id": "H0XUQ3_OTOGA",
        "source_organism": {
            "taxId": "30611",
            "scientificName": "Otolemur garnettii",
            "fullName": "Otolemur garnettii (Small-eared galago)"
        },
        "name": "Protein S100-A10",
        "description": [
            "Because S100A10 induces the dimerization of ANXA2/p36, it may function as a regulator of protein phosphorylation in that the ANXA2 monomer is the preferred target (in vitro) of tyrosine-specific kinase"
        ],
        "length": 97,
        "sequence": "MPSQVEHAMETMMFTFHKFAKDKGYLTKEDLRVLMEKEFPGFLENQKDPLALDKIMKDLDQCRDGKVGFQSFFSLIAGLTIACNDYFVVHMKQKGKK",
        "proteome": "UP000005225",
        "gene": null,
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "9fbe415715d177c71b45cd24325edde000517727",
        "counters": {
            "domain_architectures": 10240,
            "entries": 9,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cathgene3d": 1,
                "smart": 1,
                "pfam": 1,
                "panther": 1,
                "prosite": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 10240
        }
    }
}