"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"H0XUQ3"	"{'domain_architectures': 10240, 'entries': 9, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'ssf': 1, 'cathgene3d': 1, 'smart': 1, 'pfam': 1, 'panther': 1, 'prosite': 1, 'interpro': 3}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 10240}"	"['Because S100A10 induces the dimerization of ANXA2/p36, it may function as a regulator of protein phosphorylation in that the ANXA2 monomer is the preferred target (in vitro) of tyrosine-specific kinase']"	""	""	"H0XUQ3_OTOGA"	"9fbe415715d177c71b45cd24325edde000517727"	True	False	False	97	"Protein S100-A10"	3	"UP000005225"	"MPSQVEHAMETMMFTFHKFAKDKGYLTKEDLRVLMEKEFPGFLENQKDPLALDKIMKDLDQCRDGKVGFQSFFSLIAGLTIACNDYFVVHMKQKGKK"	"unreviewed"	"{'taxId': '30611', 'scientificName': 'Otolemur garnettii', 'fullName': 'Otolemur garnettii (Small-eared galago)'}"