GET /api/protein/UniProt/H0VJ29/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "H0VJ29",
        "id": "H0VJ29_CAVPO",
        "source_organism": {
            "taxId": "10141",
            "scientificName": "Cavia porcellus",
            "fullName": "Cavia porcellus (Guinea pig)"
        },
        "name": "Corrinoid adenosyltransferase MMAB",
        "description": [
            "Converts cob(I)alamin to adenosylcobalamin (adenosylcob(III)alamin), a coenzyme for methylmalonyl-CoA mutase, therefore participates in the final step of the vitamin B12 conversion. Generates adenosylcobalamin (AdoCbl) and directly delivers the cofactor to MUT in a transfer that is stimulated by ATP-binding to MMAB and gated by MMAA"
        ],
        "length": 238,
        "sequence": "MALWVGRGRVGLRGCFGTYKLLCSRFQSRDSQDVEDKDRMQPSLKTPKIPKIYTRTGDKGFSSTFTGERRPKDDQVFEALGTTDELSSAIGFAMELITEKGHTFAEELQKIQCTLQDVGSALATPRSSAREAHLKRTAFEAGSILELEQWIDKYSRQLPPLTAFILPSGGKSSAALHFCRAVCRRAERRVVPLVQMGETDANVAKFLNRLSDYLFTVARYAAMKEGNQEKIYKKTDLR",
        "proteome": "UP000005447",
        "gene": "MMAB",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "0b69bb81c0049ce839badf9467b093e3e7c08ffe",
        "counters": {
            "domain_architectures": 20974,
            "entries": 8,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "pfam": 1,
                "cathgene3d": 1,
                "panther": 1,
                "ncbifam": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 20974
        }
    }
}