GET /api/protein/UniProt/H0VJ29/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "H0VJ29",
"id": "H0VJ29_CAVPO",
"source_organism": {
"taxId": "10141",
"scientificName": "Cavia porcellus",
"fullName": "Cavia porcellus (Guinea pig)"
},
"name": "Corrinoid adenosyltransferase MMAB",
"description": [
"Converts cob(I)alamin to adenosylcobalamin (adenosylcob(III)alamin), a coenzyme for methylmalonyl-CoA mutase, therefore participates in the final step of the vitamin B12 conversion. Generates adenosylcobalamin (AdoCbl) and directly delivers the cofactor to MUT in a transfer that is stimulated by ATP-binding to MMAB and gated by MMAA"
],
"length": 238,
"sequence": "MALWVGRGRVGLRGCFGTYKLLCSRFQSRDSQDVEDKDRMQPSLKTPKIPKIYTRTGDKGFSSTFTGERRPKDDQVFEALGTTDELSSAIGFAMELITEKGHTFAEELQKIQCTLQDVGSALATPRSSAREAHLKRTAFEAGSILELEQWIDKYSRQLPPLTAFILPSGGKSSAALHFCRAVCRRAERRVVPLVQMGETDANVAKFLNRLSDYLFTVARYAAMKEGNQEKIYKKTDLR",
"proteome": "UP000005447",
"gene": "MMAB",
"go_terms": null,
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "0b69bb81c0049ce839badf9467b093e3e7c08ffe",
"counters": {
"domain_architectures": 20974,
"entries": 8,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"pfam": 1,
"cathgene3d": 1,
"panther": 1,
"ncbifam": 1,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 20974
}
}
}