"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"H0VJ29"	"{'domain_architectures': 20974, 'entries': 8, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'ssf': 1, 'pfam': 1, 'cathgene3d': 1, 'panther': 1, 'ncbifam': 1, 'interpro': 3}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 20974}"	"['Converts cob(I)alamin to adenosylcobalamin (adenosylcob(III)alamin), a coenzyme for methylmalonyl-CoA mutase, therefore participates in the final step of the vitamin B12 conversion. Generates adenosylcobalamin (AdoCbl) and directly delivers the cofactor to MUT in a transfer that is stimulated by ATP-binding to MMAB and gated by MMAA']"	"MMAB"	""	"H0VJ29_CAVPO"	"0b69bb81c0049ce839badf9467b093e3e7c08ffe"	True	False	False	238	"Corrinoid adenosyltransferase MMAB"	3	"UP000005447"	"MALWVGRGRVGLRGCFGTYKLLCSRFQSRDSQDVEDKDRMQPSLKTPKIPKIYTRTGDKGFSSTFTGERRPKDDQVFEALGTTDELSSAIGFAMELITEKGHTFAEELQKIQCTLQDVGSALATPRSSAREAHLKRTAFEAGSILELEQWIDKYSRQLPPLTAFILPSGGKSSAALHFCRAVCRRAERRVVPLVQMGETDANVAKFLNRLSDYLFTVARYAAMKEGNQEKIYKKTDLR"	"unreviewed"	"{'taxId': '10141', 'scientificName': 'Cavia porcellus', 'fullName': 'Cavia porcellus (Guinea pig)'}"
