General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "H0VEC0",
        "id": "H0VEC0_CAVPO",
        "source_organism": {
            "taxId": "10141",
            "scientificName": "Cavia porcellus",
            "fullName": "Cavia porcellus (Guinea pig)"
        },
        "name": "Mitochondrial carnitine/acylcarnitine carrier protein",
        "description": [
            "Mediates the electroneutral exchange of acylcarnitines (O-acyl-(R)-carnitine or L-acylcarnitine) of different acyl chain lengths (ranging from O-acetyl-(R)-carnitine to long-chain O-acyl-(R)-carnitines) with free carnitine ((R)-carnitine or L-carnitine) across the mitochondrial inner membrane, via a ping-pong mechanism. Key player in the mitochondrial oxidation pathway, it translocates the fatty acids in the form of acylcarnitines into the mitochondrial matrix, where the carnitine palmitoyltransferase 2 (CPT-2) activates them to undergo fatty acid beta-oxidation. Catalyzes the unidirectional transport (uniport) of carnitine at lower rates than the antiport (exchange)"
        ],
        "length": 301,
        "sequence": "MAEEPKPISPLKNLLAGGFGGVCLVFVGHPLDTVKVRLQTQPASLPGQSPMYSGTFDCFRKTLLREGITGLYRGMAAPIIGVTPMFAVCFFGFGLGKKLQQKSPEDVLSYSEIFAAGMLSGVFTTGIMTPGERIKCLLQIQASSGETKYNGPLDCAKKLYQESGIRGIYKGTVLTLMRDVPASGMYFMTYEWLKNILTPEGKSVSDLSVPRILVAGGTAGIFNWAVAIPPDVLKSRFQTAPPGKYPNGFRDVLTELIQKEGITSLYKGFNAVMIRAFPANAACFLGFEVAMKFLNWLTPNL",
        "proteome": "UP000005447",
        "gene": "SLC25A20",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "e037822792ef5f5d7967370632f8bf737b916266",
        "counters": {
            "domain_architectures": 140476,
            "entries": 8,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "profile": 1,
                "pfam": 1,
                "panther": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 140476
        }
    }
}