"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"H0VEC0"	"{'domain_architectures': 140476, 'entries': 8, 'isoforms': 0, 'proteomes': 1, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'profile': 1, 'pfam': 1, 'panther': 1, 'interpro': 3}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 140476}"	"['Mediates the electroneutral exchange of acylcarnitines (O-acyl-(R)-carnitine or L-acylcarnitine) of different acyl chain lengths (ranging from O-acetyl-(R)-carnitine to long-chain O-acyl-(R)-carnitines) with free carnitine ((R)-carnitine or L-carnitine) across the mitochondrial inner membrane, via a ping-pong mechanism. Key player in the mitochondrial oxidation pathway, it translocates the fatty acids in the form of acylcarnitines into the mitochondrial matrix, where the carnitine palmitoyltransferase 2 (CPT-2) activates them to undergo fatty acid beta-oxidation. Catalyzes the unidirectional transport (uniport) of carnitine at lower rates than the antiport (exchange)']"	"SLC25A20"	""	"H0VEC0_CAVPO"	"e037822792ef5f5d7967370632f8bf737b916266"	True	False	False	301	"Mitochondrial carnitine/acylcarnitine carrier protein"	3	"UP000005447"	"MAEEPKPISPLKNLLAGGFGGVCLVFVGHPLDTVKVRLQTQPASLPGQSPMYSGTFDCFRKTLLREGITGLYRGMAAPIIGVTPMFAVCFFGFGLGKKLQQKSPEDVLSYSEIFAAGMLSGVFTTGIMTPGERIKCLLQIQASSGETKYNGPLDCAKKLYQESGIRGIYKGTVLTLMRDVPASGMYFMTYEWLKNILTPEGKSVSDLSVPRILVAGGTAGIFNWAVAIPPDVLKSRFQTAPPGKYPNGFRDVLTELIQKEGITSLYKGFNAVMIRAFPANAACFLGFEVAMKFLNWLTPNL"	"unreviewed"	"{'taxId': '10141', 'scientificName': 'Cavia porcellus', 'fullName': 'Cavia porcellus (Guinea pig)'}"
