GET /api/protein/UniProt/G9NN30/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "G9NN30",
        "id": "G9NN30_HYPAI",
        "source_organism": {
            "taxId": "452589",
            "scientificName": "Hypocrea atroviridis (strain ATCC 20476 / IMI 206040)",
            "fullName": "Hypocrea atroviridis (strain ATCC 20476 / IMI 206040)"
        },
        "name": "Ribonuclease P/MRP protein subunit POP5",
        "description": [
            "Component of ribonuclease P, a protein complex that generates mature tRNA molecules by cleaving their 5'-ends. Also a component of RNase MRP, which cleaves pre-rRNA sequences"
        ],
        "length": 181,
        "sequence": "MVRIKERYLLVNLVYPPDAARISKARVPGLVAQHQPTVEKLTPQALVRAIRAEVSLLYGDYGAGALEGNLSVKYLSLATSTFILRCNRAHYQLLWSALTFMDRVPVKDGRPCIFRVVRVSGTIRKIEEVAVARARKLILAAKAEASGHPQSSLSTDILGTKDDAVLDVDNVMSDEDMEDGS",
        "proteome": "UP000005426",
        "gene": "TRIATDRAFT_81737",
        "go_terms": [
            {
                "identifier": "GO:0001682",
                "name": "tRNA 5'-leader removal",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0030677",
                "name": "ribonuclease P complex",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "cc289a3e480251aca41cfdbf007f8359cd20e3e1",
        "counters": {
            "domain_architectures": 5853,
            "entries": 6,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "panther": 1,
                "pfam": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 5853
        }
    }
}