GET /api/protein/UniProt/G9NN30/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "G9NN30",
"id": "G9NN30_HYPAI",
"source_organism": {
"taxId": "452589",
"scientificName": "Hypocrea atroviridis (strain ATCC 20476 / IMI 206040)",
"fullName": "Hypocrea atroviridis (strain ATCC 20476 / IMI 206040)"
},
"name": "Ribonuclease P/MRP protein subunit POP5",
"description": [
"Component of ribonuclease P, a protein complex that generates mature tRNA molecules by cleaving their 5'-ends. Also a component of RNase MRP, which cleaves pre-rRNA sequences"
],
"length": 181,
"sequence": "MVRIKERYLLVNLVYPPDAARISKARVPGLVAQHQPTVEKLTPQALVRAIRAEVSLLYGDYGAGALEGNLSVKYLSLATSTFILRCNRAHYQLLWSALTFMDRVPVKDGRPCIFRVVRVSGTIRKIEEVAVARARKLILAAKAEASGHPQSSLSTDILGTKDDAVLDVDNVMSDEDMEDGS",
"proteome": "UP000005426",
"gene": "TRIATDRAFT_81737",
"go_terms": [
{
"identifier": "GO:0001682",
"name": "tRNA 5'-leader removal",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0030677",
"name": "ribonuclease P complex",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "cc289a3e480251aca41cfdbf007f8359cd20e3e1",
"counters": {
"domain_architectures": 5853,
"entries": 6,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"panther": 1,
"pfam": 1,
"interpro": 2
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 5853
}
}
}