"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"G9NN30"	"{'domain_architectures': 5853, 'entries': 6, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'panther': 1, 'pfam': 1, 'interpro': 2}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 5853}"	"[""Component of ribonuclease P, a protein complex that generates mature tRNA molecules by cleaving their 5'-ends. Also a component of RNase MRP, which cleaves pre-rRNA sequences""]"	"TRIATDRAFT_81737"	"[{'identifier': 'GO:0001682', 'name': ""tRNA 5'-leader removal"", 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0030677', 'name': 'ribonuclease P complex', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"G9NN30_HYPAI"	"cc289a3e480251aca41cfdbf007f8359cd20e3e1"	True	False	False	181	"Ribonuclease P/MRP protein subunit POP5"	3	"UP000005426"	"MVRIKERYLLVNLVYPPDAARISKARVPGLVAQHQPTVEKLTPQALVRAIRAEVSLLYGDYGAGALEGNLSVKYLSLATSTFILRCNRAHYQLLWSALTFMDRVPVKDGRPCIFRVVRVSGTIRKIEEVAVARARKLILAAKAEASGHPQSSLSTDILGTKDDAVLDVDNVMSDEDMEDGS"	"unreviewed"	"{'taxId': '452589', 'scientificName': 'Hypocrea atroviridis (strain ATCC 20476 / IMI 206040)', 'fullName': 'Hypocrea atroviridis (strain ATCC 20476 / IMI 206040)'}"