General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "G9KQR1",
        "id": "G9KQR1_MUSPF",
        "source_organism": {
            "taxId": "9669",
            "scientificName": "Mustela putorius furo",
            "fullName": "Mustela putorius furo (European domestic ferret)"
        },
        "name": "Sperm surface protein Sp17",
        "description": [
            "Sperm surface zona pellucida binding protein. Helps to bind spermatozoa to the zona pellucida with high affinity. Might function in binding zona pellucida and carbohydrates"
        ],
        "length": 148,
        "sequence": "MSIPFSNTHYRIPQGFGNLLEGLTREILREQPENIPAFAAAYFENLLEKREKTNFDPAEWGTKVDDRFYNNHAFKEHESPESCESEKEKSSTSVKEDETPVKVLETSEEEERENAALKIQAAFRGYLAREEVKKMKSGEAQEEKREEN",
        "proteome": null,
        "gene": null,
        "go_terms": [
            {
                "identifier": "GO:0005515",
                "name": "protein binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0007339",
                "name": "binding of sperm to zona pellucida",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0016020",
                "name": "membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 2,
        "source_database": "unreviewed",
        "is_fragment": true,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "2790739298a624d77991bde6f9de5ce54c438aec",
        "counters": {
            "domain_architectures": 444,
            "entries": 16,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 3,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "ssf": 1,
                "cdd": 2,
                "pfam": 2,
                "smart": 2,
                "profile": 1,
                "panther": 1,
                "pirsf": 1,
                "interpro": 4
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 444
        }
    }
}