"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"G9KQR1"	"{'domain_architectures': 444, 'entries': 16, 'isoforms': 0, 'proteomes': 0, 'sets': 3, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 2, 'ssf': 1, 'cdd': 2, 'pfam': 2, 'smart': 2, 'profile': 1, 'panther': 1, 'pirsf': 1, 'interpro': 4}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 444}"	"['Sperm surface zona pellucida binding protein. Helps to bind spermatozoa to the zona pellucida with high affinity. Might function in binding zona pellucida and carbohydrates']"	""	"[{'identifier': 'GO:0005515', 'name': 'protein binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0007339', 'name': 'binding of sperm to zona pellucida', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0016020', 'name': 'membrane', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"G9KQR1_MUSPF"	"2790739298a624d77991bde6f9de5ce54c438aec"	True	False	True	148	"Sperm surface protein Sp17"	2	""	"MSIPFSNTHYRIPQGFGNLLEGLTREILREQPENIPAFAAAYFENLLEKREKTNFDPAEWGTKVDDRFYNNHAFKEHESPESCESEKEKSSTSVKEDETPVKVLETSEEEERENAALKIQAAFRGYLAREEVKKMKSGEAQEEKREEN"	"unreviewed"	"{'taxId': '9669', 'scientificName': 'Mustela putorius furo', 'fullName': 'Mustela putorius furo (European domestic ferret)'}"
