General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "G8UM06",
        "id": "G8UM06_TANFA",
        "source_organism": {
            "taxId": "203275",
            "scientificName": "Tannerella forsythia (strain ATCC 43037 / JCM 10827 / CCUG 21028 A / KCTC 5666 / FDC 338)",
            "fullName": "Tannerella forsythia (strain ATCC 43037 / JCM 10827 / CCUG 21028 A / KCTC 5666 / FDC 338)"
        },
        "name": "Probable nicotinate-nucleotide adenylyltransferase",
        "description": [
            "Catalyzes the reversible adenylation of nicotinate mononucleotide (NaMN) to nicotinic acid adenine dinucleotide (NaAD)"
        ],
        "length": 201,
        "sequence": "MKTVGIFSGSFNPIHIGHLALANWICEYEPLDELWFLVTPHNPLKAENTLMNDHFRLSLVEVSIKDYGKFRASDFEFSLPRPSYTIHTLRALRKAYPEVLFVLIVGSDSWSNLSRWKESEALIREFPIWIYPRQGYEVAIPPDLPAVRCLNAPIIEISSTFIRQAIREEKDVRFFLSEAVWEYIPEIRKSLERNEKKYSFG",
        "proteome": "UP000005436",
        "gene": "nadD",
        "go_terms": [
            {
                "identifier": "GO:0016779",
                "name": "nucleotidyltransferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0009435",
                "name": "NAD+ biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0003824",
                "name": "catalytic activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0009058",
                "name": "biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "67074276eca3dd0a1392f72a13e344b6dc27e68b",
        "counters": {
            "domain_architectures": 82434,
            "entries": 10,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "cdd": 1,
                "pfam": 1,
                "panther": 1,
                "hamap": 1,
                "ncbifam": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 82434
        }
    }
}