"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"G8UM06"	"{'domain_architectures': 82434, 'entries': 10, 'isoforms': 0, 'proteomes': 1, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'cdd': 1, 'pfam': 1, 'panther': 1, 'hamap': 1, 'ncbifam': 1, 'interpro': 3}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 82434}"	"['Catalyzes the reversible adenylation of nicotinate mononucleotide (NaMN) to nicotinic acid adenine dinucleotide (NaAD)']"	"nadD"	"[{'identifier': 'GO:0016779', 'name': 'nucleotidyltransferase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0009435', 'name': 'NAD+ biosynthetic process', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0003824', 'name': 'catalytic activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0009058', 'name': 'biosynthetic process', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"G8UM06_TANFA"	"67074276eca3dd0a1392f72a13e344b6dc27e68b"	True	False	False	201	"Probable nicotinate-nucleotide adenylyltransferase"	3	"UP000005436"	"MKTVGIFSGSFNPIHIGHLALANWICEYEPLDELWFLVTPHNPLKAENTLMNDHFRLSLVEVSIKDYGKFRASDFEFSLPRPSYTIHTLRALRKAYPEVLFVLIVGSDSWSNLSRWKESEALIREFPIWIYPRQGYEVAIPPDLPAVRCLNAPIIEISSTFIRQAIREEKDVRFFLSEAVWEYIPEIRKSLERNEKKYSFG"	"unreviewed"	"{'taxId': '203275', 'scientificName': 'Tannerella forsythia (strain ATCC 43037 / JCM 10827 / CCUG 21028 A / KCTC 5666 / FDC 338)', 'fullName': 'Tannerella forsythia (strain ATCC 43037 / JCM 10827 / CCUG 21028 A / KCTC 5666 / FDC 338)'}"