GET /api/protein/UniProt/G8JUM1/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "G8JUM1",
        "id": "G8JUM1_ERECY",
        "source_organism": {
            "taxId": "931890",
            "scientificName": "Eremothecium cymbalariae (strain CBS 270.75 / DBVPG 7215 / KCTC 17166 / NRRL Y-17582)",
            "fullName": "Eremothecium cymbalariae (strain CBS 270.75 / DBVPG 7215 / KCTC 17166 / NRRL Y-17582) (Yeast)"
        },
        "name": "Mitochondrial import inner membrane translocase subunit TIM22",
        "description": [
            "Essential core component of the TIM22 complex, a complex that mediates the import and insertion of multi-pass transmembrane proteins into the mitochondrial inner membrane. In the TIM22 complex, it constitutes the voltage-activated and signal-gated channel. Forms a twin-pore translocase that uses the membrane potential as external driving force in 2 voltage-dependent steps"
        ],
        "length": 201,
        "sequence": "MVYRGFGLEHISPPVNKPFNEMTPDEQGERGAQMMVDFMTSCPGKSIISGVTGFALGGIFGMFMASMAYDTPLHTPSPANLGPGAGIPGVQTIQQMADLPLKQQIKIQFTDMGKRAYSSAKNFGYIGMIYSGVECAVESLRAKNDIYNGVAAGCLTGGGLAYKSGPSAALIGCAGFAAFSTAIDLYMRHENGVPPKDDFNE",
        "proteome": "UP000006790",
        "gene": "Ecym_6430",
        "go_terms": [
            {
                "identifier": "GO:0045039",
                "name": "protein insertion into mitochondrial inner membrane",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0042721",
                "name": "TIM22 mitochondrial import inner membrane insertion complex",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "d248dad29de54a4a0cf8922bb2c3f57bcdeaa5f8",
        "counters": {
            "domain_architectures": 24356,
            "entries": 3,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "panther": 1,
                "pfam": 1,
                "interpro": 1
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 24356
        }
    }
}